Tag Archives: Selbstverwirklichung

Allgemein

Trend: Digitale Selbstverwirklichung mit eigener Website

Trend: Digitale Selbstverwirklichung mit eigener Website

Eigene Website erzeugt positive Emotionen

-Umfrage von GoDaddy und YouGov belegt: Mehr Menschen bauen eine Website – 22 Prozent der Deutschen haben schon eine Idee ins Netz gebracht
-39 Prozent half die eigene Website, sich selbst zu verwirklichen
-Website mit starken Emotionen verbunden: Zufriedenheit (45 Prozent), Stolz (37 Prozent) und Glück (30 Prozent)
-Glücksexperiment soll Erkenntnisse vertiefen

Köln, 17. Mai 2018: Mit sinkenden technischen Hürden bauen immer mehr Menschen eine Website: 22 Prozent der Deutschen haben schon selbst eine Idee ins Netz gebracht, zwei Drittel davon sind Männer, ein Drittel Frauen. Für viele Website-Betreiber trägt dieser Schritt erheblich zur Selbstverwirklichung und gar zum eigenen Glück bei. Das zeigen Ergebnisse einer von GoDaddy und dem Forschungsinstitut YouGov durchgeführten repräsentativen Umfrage. Zur Vertiefung dieser Ergebnisse startet GoDaddy, die weltweit größte Cloud-Plattform für Kleinunternehmen, ein Glücksexperiment.

Von den Befragten mit eigener Website betreiben 57 Prozent eine private Seite, 23 Prozent nutzen sie für die eigene Selbständigkeit. Der Großteil verfolgt demnach private Zwecke (53 Prozent), gefolgt von Werbezwecken (23 Prozent), dem Einsatz als Online-Visitenkarte (18 Prozent), gemeinnützigen Zielen (14 Prozent) und Verkaufsabsichten mit einem Online-Shop (13 Prozent).

Unabhängig vom Zweck können von der eigenen Website starke positive Impulse für das eigene Leben ausgehen: Für 56 Prozent der Website-Betreiber war es ein erfüllendes Projekt, eine Website selbst zu gestalten. 39 Prozent bestätigen, dass ihre Website ihnen dabei half, sich selbst zu verwirklichen. Für ein Viertel der Website-Besitzer war der Effekt so stark, dass sich mit dem Start der eigenen Website ihr Leben zum Positiven verändert hat.

Wer einen eigenen Webauftritt gestaltet hat, verknüpft mit deutlicher Tendenz positive Emotionen mit der eigenen Website. Bei der Auswahl aus einer Liste von zehn positiven und sieben negativen Gefühlen verbinden die Website-Starter am häufigsten Zufriedenheit (45 Prozent), Stolz (37 Prozent) und Glück (30 Prozent) mit dem Moment des Onlinegehens. Auch bei der Frage, mit welchen Emotionen sie heute an ihre Website denken, liegen die positiven Assoziationen ganz vorne – mit leicht geringeren Zustimmungsraten.

„Aus der Positiven Psychologie wissen wir, dass unsere Lebenszufriedenheit zur Hälfte genetisch bestimmt wird, 40 Prozent können jedoch durch eigenes Handeln beeinflusst werden“, erklärt Glückswissenschaftlerin Saskia Rudolph. „Das Entwerfen und Erstellen einer Website regt die Kreativität an und fördert die eigene Motivation, wie die Ergebnisse der Umfrage zeigen. Hier arbeiten Menschen also aktiv an ihrem Glück. Das belegt auch die Tatsache, dass sich die meisten in der Rückschau als „zufrieden“ mit ihrer persönlich wichtigsten Website bezeichnen: Da über die Zeit extreme Gefühle eher nachlassen, sich hier aber eine langanhaltende Zufriedenheit eingestellt hat, ist dies ein positiver und psychologisch gesunder Trend.“

„Durch meine Arbeit, aber auch im privaten Umfeld habe ich schon viele schöne Geschichten erlebt, die ihren Ausgangspunkt in einer neuen Website fanden: Ein Motorradshop, der mit seinen aufwendig restaurierten Bikes viele Liebhaber im Netz begeistert, oder ein Freund, der mir aufgeregt den Link zu seiner neuen Website schickte, die für ihn den Schritt in die Selbständigkeit bedeutete. Daher habe ich damit gerechnet, dass Menschen Stolz und Zufriedenheit mit ihrem Webprojekt verbinden. Doch dass die eigene Website bei vielen so starke Emotionen wie langanhaltendes Glück auslöst, hat uns überrascht. Diesen Effekt wollen wir im Glücksexperiment, das wir aktuell durchführen, genauer untersuchen“, kommentiert Paul Ashcroft, Group Marketing Director von GoDaddy.

Anfang des Jahres startete GoDaddy offiziell in Deutschland mit dem Website Builder, der es Nutzern erleichtert, ihre Online-Präsenz zu erstellen und zu verwalten. Außerdem bietet das Unternehmen eine Reihe von integrierten Online-Produkten, einschließlich Domain-Namen-Registrierung, Hosting und E- Commerce, zusammen mit Produktivitäts- und Sicherheitsschutz-Tools, um Online-Unternehmen beim Wachstum zu unterstützen.

Zur Methodik:
Die Daten basieren auf einer gemeinsamen Umfrage von YouGov und GoDaddy. An der Befragung im März 2018 nahmen 2.037 Befragte aus Deutschland im Alter ab 18 Jahren teil. Davon haben 22 Prozent bereits eine eigene Website erstellt. Ausgenommen sind Teilnehmer, die Websites beruflich erstellen. Die dargestellten Ergebnisse beruhen auf den Angaben derjenigen 439 Personen, die bereits mindestens eine Website erstellt haben und dies nicht beruflich tun. Die Ergebnisse sind für diese Gruppe repräsentativ nach Alter, Geschlecht und Region.

Über GoDaddy:
GoDaddy ist die größte Cloud-Plattform weltweit, die sich auf kleine, unabhängige Unternehmen konzentriert. Mit mehr als 17,5 Millionen Kunden weltweit und mehr als 76 Millionen verwalteten Domains ist GoDaddy der erste Ansprechpartner für Menschen, die ihrer Idee einen Namen geben, eine professionelle Website erstellen, Kunden gewinnen und ihre Arbeit produktiver gestalten wollen. Unsere Mission ist es, unseren Kunden die richtigen Tools, Know-how und die Unterstützung an die Hand zu geben, um ihre Ideen und Projekte erfolgreich zu machen. Weitere Informationen unter https://de.GoDaddy.com

Firmenkontakt
GoDaddy Deutschland GmbH
Celia Gastaldi-Höppner
Hansestraße 111
51149 Köln
0049 (0)30 61625555
godaddy@frische-fische.com
https://de.godaddy.com

Pressekontakt
Agentur Frische Fische
Celia Gastaldi-Höppner
Schlesische Str. 28
10997 Berlin
+49 (0)30 6167 5555
cg@frische-fische.com
http://www.frische-fische.com

Allgemein

Das Sabbatjahr als Motivationskick für Mitarbeiter

Aktuelle Studie: Wie bewerten Unternehmen das Recht auf Auszeit?

Das Sabbatjahr als Motivationskick für Mitarbeiter

Die Mehrheit der Unternehmen steht dem Recht auf ein Sabbatical positiv bis neutral gegenüber.

Mehrere Monate Auszeit nehmen um zu reisen, sich weiterzubilden oder sich um die Familie zu kümmern – davon träumen viele Arbeitnehmer. Dieser Wunsch könnte nun leichter Realität werden, denn die Politik diskutiert ein Gesetz, das jedem das Recht auf zwei Sabbatjahre im Laufe der Karriere einräumen würde. Aber wie reagieren die Arbeitgeber auf diesen Vorschlag? Die aktuelle Randstad-ifo-Personalleiterbefragung hat herausgefunden: erstaunlich gelassen. 82% der Personaler sind grundsätzlich offen für das Sabbatjahr, 26% rechnen sogar mit einem positiven Effekt für das Unternehmen. Sie versprechen sich vor allem motiviertere Mitarbeiter.

Laut dem Gesetzesvorschlag stünden jedem Arbeitnehmer gesetzlich zwei Berufsunterbrechungen von je maximal einem Jahr zu. Die Pausen sollen für diverse Aktivitäten wie zum Beispiel Auslandserfahrungen, persönliche berufliche Weiterentwicklung oder Familienzeit genutzt werden können. Während des Sabbaticals verzichten die Arbeitnehmer auf ihr Gehalt oder lassen sich angesparte Überstunden auszahlen.

56% der befragten Unternehmen stehen diesem Modell neutral gegenüber: Sie erwarten dadurch keine unmittelbaren Konsequenzen für ihren Personalstand. Am ehesten findet das Recht auf Auszeit Zuspruch im Verarbeitenden Gewerbe, wo 29% für den Vorschlag sind. Unter den Dienstleistern sind es 27%, der Handel ist mit 22% etwa skeptischer. In allen Branchen rechnen die Fürsprecher damit, dass die Angestellten voller Tatendrang zurückkehren und eventuell neue Kompetenzen – persönliche oder professionelle – in den Job einbringen. „Ein Angebot für ein Sabbatical kann für Arbeitnehmer eine zusätzliche Motivationsquelle sein und zur Mitarbeiterzufriedenheit beitragen, da es Vertrauen signalisiert. Die Studienergebnisse zeigen, dass viele Personalleiter dem Konzept offen gegenüber stehen“, so Petra Timm, Director Group Communications bei Randstad.

Zur Randstad-ifo-Personalleiterbefragung
Die in Zusammenarbeit von Randstad und dem ifo-Institut entwickelte Randstad-ifo- Personalleiterbefragung zeigt die langfristige Bedeutung und Funktion von Flexibilisierung im Personaleinsatz. Dazu werden vierteljährlich mehr als 1.000 Personalleiter befragt. Im Rahmen der Sonderfrage werden zusätzlich aktuelle Personalthemen aufgegriffen. Mehr Informationen und den kompletten Berichtsband der Studie zum Download gibt es unter www.randstad.de/publikationen

Mit durchschnittlich rund 58.000 Mitarbeitern und rund 500 Niederlassungen in 300 Städten sowie einem Umsatz von rund 2,1 Milliarden Euro (2016) ist die Randstad Gruppe der führende Personaldienstleister in Deutschland. Randstad bietet Unternehmen unterschiedlicher Branchen umfassende Personalservice-Konzepte. Neben der klassischen Zeitarbeit gehören zum Portfolio der Randstad Gruppe unter anderem die Geschäftsbereiche Professional Services, Personalvermittlung, HR Lösungen und Inhouse Services. Mit seinen passgenauen Personallösungen ist Randstad ein wichtiger strategischer Partner für seine Kundenunternehmen. Durch die langjährige Erfahrung unter anderem in der Personalvermittlung und Personalüberlassung sowie individuelle Leistungs- und Entwicklungsangebote für Mitarbeiter und Bewerber, ist Randstad auch für Fach- und Führungskräfte ein attraktiver Arbeitgeber und Dienstleister. Als Impulsgeber für den Arbeitsmarkt hat Randstad bereits im Jahr 2000 einen flächendeckenden Tarifvertrag mit ver.di abgeschlossen, der als Grundlage für die geltenden tariflichen Regelungen in der gesamten Branche diente. Randstad ist seit knapp 50 Jahren in Deutschland aktiv und gehört zur niederländischen Randstad Holding nv: mit einem Gesamtumsatz von rund 20,7 Milliarden Euro (Jahr 2016), über 620.000 Mitarbeitern täglich im Einsatz und ca. 5.800 Niederlassungen in 40 Ländern, ist Randstad einer der größten Personaldienstleister weltweit. Zur deutschen Randstad Gruppe gehören neben den Unternehmen Randstad Deutschland GmbH & Co KG auch die Unternehmen Tempo Team, Gulp, Monster, twago, Randstad Sourceright, Randstad Outsourcing GmbH sowie Randstad Automotive und Randstad Financial Services.

Firmenkontakt
Randstad Deutschland
Petra Timm
Helfmann-Park 8
65760 Eschborn
06196/4081770
06196-408 1775
presse@randstad.de
http://www.randstad.de

Pressekontakt
Randstad Deutschland Pressestelle
Helene Schmidt
Helfmann-Park 8
65760 Eschborn
06196/4081701
06196-408 1775
helene.schmidt@randstad.de
http://www.randstad.de

Allgemein

Die Bequemlichkeits-Falle

Life Coach Anja Faras gibt Tipps, wie man ein selbstbestimmtes Leben führen kann

Die Bequemlichkeits-Falle

Selbstverwirklichung ist ihr Spezial-Gebiet: Life Coach und Sport Mental Coach Anja Faras

Jeder Mensch kommt im Laufe seines Lebens mindestens einmal an einen Punkt, an dem er sein Leben reflektiert und sich fragt: Lebe ich eigentlich das Leben, das ich leben will? Bei relativ vielen Menschen heißt die Antwort trauriger Weise „Nein“, weiß auch Life Coach und Sport Mental Coach Anja Faras aus ihrer Praxiserfahrung. „Es gibt viele Menschen, die unglücklich sind und das Gefühl haben, im falschen Leben zu leben“, so Faras. Das sei aber noch lange kein Grund, den Kopf in den Sand zu stecken. Die Expertin für mentale Stärke weiß, wie man sich selbst verwirklichen und sein Leben dahingehend verändern kann, dass es für einen selbst das „richtige“ Leben ist.

Oftmals wurden die Weichen für die Unzufriedenheit schon in Kindheit und Jugend gestellt. „Wenn wir uns das erste Mal fragen müssen, wohin unsere Reise gehen soll, haben die meisten noch keine Ahnung davon, was sie wollen. Vieles ist durch das Elternhaus, durch die Schule und die Werte, die dort gelebt werden, geprägt“, so Faras. Diese Werte werden dann einfach weitergelebt und sind so verfestigt, dass es vielen Menschen schwerfällt, sich aus diesem Konstrukt wieder herauszubewegen.

Zunächst heißt es Mut aufbringen, denn „Viele Menschen trauen sich gar nicht erst, solche Dinge anzusprechen. Aber nur, wenn ich etwas anspreche, kann ich auch nach Lösungen suchen. Dieses „etwas aushalten müssen“ ist leider weit verbreitet,“ weiß die Expertin. Viele Menschen leben daher unter ihrem Potenzial, weil sie glauben, sie müssten etwas aushalten. „Dadurch begibt man sich in eine Fremdbestimmung, aus der man wieder raus muss. Es läuft dann alles auf die Frage hinaus: Was will ich eigentlich?“

Um das herauszufinden, benutzt Anja Faras in ihrem Coaching dafür häufig das Sinnbild eines Biotops: „Ich frage meine Coachees, wie ihre persönliche Wohlfühl-Umgebung aussieht. Was brauchen sie, um wachsen und gedeihen zu können? Was sind ihre Bedürfnisse?“ Weiterhin gilt es herauszufinden, was Menschen konkret davon abhält, sich zu verändern. Und wer oder was ihnen bei Veränderungen helfen könnte. „Jeder muss sich fragen: Was könnte im schlimmsten Fall passieren? Und im besten? Denn nur wer sich Klarheit verschafft, kann etwas verändern und ein selbstbestimmtes Leben führen“, schließt Anja Faras.

Weitere Informationen über Life Coach und Sport Mental Coach Anja Faras – The Art of Living finden Sie unter: www.anja-faras.de.

Ob im Business, im Sport oder im Alltag – Anja Faras begleitet als Life Coach und Sport Mental Coach Menschen dabei, ein Leben mit mehr Lebensqualität zu führen. Durch ihre Faszination für Sport und ihre Begeisterung für Fußball hat Faras schon früh erkannt: Wer mental stark ist, kann Höchstleistung auf den Punkt abrufen. Wer mental stark und fokussiert ist, kann gelassen und souverän Herausforderungen angehen und sein Know-how abrufen, wenn es gebraucht wird. Anja Faras bietet neben Life Coaching und Sport Mental Coaching außerdem Workshops und Vorträge zum Thema an. Ihr Credo: Leben Sie das Leben, das Sie leben möchten!

Kontakt
Anja Faras – The Art of Living
Anja Faras
Neckartal 180
78628 Rottweil
+49 (0) 151 544 094 14
info@anja-faras.de
http://www.anja-faras.de

Allgemein

Berufswahl: Was wird aus mir wenn ich groß bin?

Kindergarten, Schule, Abschluss und dann? Viele Jugendliche stehe vor dieser spannenden Frage. Welcher Lebensentwurf passt? Studium, Ausbildung, Travel and Work oder Lebenskünstler? Diskussionsbeitrag von Norbert Hahn, Hahn Fertigungstechnik GmbH

Berufswahl: Was wird aus mir wenn ich groß bin?

Was wird aus mir wenn ich groß bin? Spanende Bearbeitung einer Buchse – Hahn Fertigungstechnik GmbH

Was im Leben anfangen – welchen Beruf wählen?

Was waren die Zeiten noch einfach, als der Sohn das wurde was Papa war und die Töchter sich an ihren Müttern orientiert haben!? Die Qual der Wahl: Beruf und Job, Chancen und Karriere, Glück, Sinn und Lebensinnhalt? Hahn Fertigungstechnik GmbH sucht jedes Jahr Auszubildende. Möchte jungen Menschen die „Chance Azubi“ einen Platz zur Ausbildung bieten. Mit der qualitativen Ausbildung des Nachwuchses trägt das Unternehmen Hahn zur Zukunft der Auszubildenden und der Betriebe bei. Wichtigster Motivator liegt in der Weitergabe des umfassenden fachlichen Know-Hows, beruflichen Weiterbildung, Sicherheit zum Wohlstand und an der Mitgestaltung der Zukunft. Wie junge Menschen zur Ausbildung und der Berufswahl motivieren? Norbert Hahn, Geschäftsführer der Hahn Fertigungstechnik GmbH in Papenburg an der Ems im Nord-Westen Niedersachsens, sieht Diskussionsbedarf zu Thema Berufswahl und Fachkräftemangel.

Stellenwert Beruf – berufliche Laufbahn

Der Beruf trägt zur eigenen Identifikation und gesellschaftlichen Stellung bei. „Bedürfnis nach Sicherheit prägte den Berufswunsch der Nachkriegsgeneration. Bürgerliche Berufe gaben ein sicheres Auskommen und ein geregeltes Leben. Mit dem Wunsch nach Selbstverwirklichung strebten die 68ziger in den Fokus, neue kreative und soziale Berufsbilder etablierten sich am Markt und in der Gesellschaft. Die ideelle Selbstverwirklichung und parallel dazu die Emanzipation sorgten für neue Lebensentwürfe. Seit den siebziger Jahren hat die Jungend Wahlfreiheit. Damit eng verbunden ist die Erwartungshaltung, aus dem eigenen Leben sinnvolles zu gestalten. Dann mal los!“, fordert Norbert Hahn den Teilnehmerkreis sportlich auf.

Chance Azubi in der digitalen, hoch komplexen, flexibilisierten und globalisierten Welt?

Sich entscheiden, eine Wahl treffen ist schwierig und in jungen Jahren besonders schwer: „Der Schulabschluss rückt näher, was machen? Wozu habe ich Lust? Was macht Sinn und mich glücklich? Wo verdiene ich genügend? Wird der Beruf wegrationalisiert durch die Digitalisierung?“ Bekannte Fragen bei der Berufswahl. Zudem steigt der Erwartungsdruck, die Leistungsgesellschaft fordert und der Wunsch das Leben sinnvoll zu gestalten wird laut. Hahn Fertigungstechnik blickt auf eine jahrelange Unternehmenserfolgsgeschichte und Norbert Hahn kennt die Bedenken und Fragen der Jugend und deren Eltern. Formate wie Chance Azubi, Jobbörsen, Coachings von Arbeitsagenturen, Praktika und das ehrenamtliche Engagement liefern Unterstützung bei der Wahl. Entscheidend für junge Menschen ist, einen Einblick und Wissen über das Tun, Werken, Wirken und Handeln im Berufsalltag zu erfahren.

Was macht ein Feinwerkmechaniker im Berufsalltag? Wird produziert oder repariert, entwickelt oder nach Vorlage gefertigt? Wie gestaltet sich der Berufsalltag eines Feinwerkmechanikers?

Hahn Fertigungstechnik bildet den Beruf des Feinmechanikers aus. „Feinwerkmechaniker (m/w) stellen Werkstücke für Maschinen und feinmechanische Geräte her, reparieren und montieren diese und fertigen Stanz-, Umformungswerkzeuge und Stahlformen. Feinwerkmechaniker ist ein anerkannter Ausbildungsberuf nach der Handwerksordnung (HwO). Die Ausbildung ist bundesweit geregelt und dauert 3,5 Jahre“, ein kurze Berufsvorstellung. Aber was genau wird getan?

Grundlagen der Zerspanungstechnik: Spanbildung und Spanarten

Hahn Fertigungstechnik GmbH hat sich auf die Zerspanung spezialisiert. Die Spanbildung ist eine annähernd plastische Verformung des Werkstoffs. Der Schneidkeil dringt in den Werkstoff ein und Zerspanung wird hervorgerufen. Dabei wird der Werkstoff gestaucht bis die Stauchkraft so groß ist, dass die Scherung des Werkstoffs entlang der Scherebene, in dünne Lamellen bewirken wird.

Die Spanart ist vom Werkstoff und den Spanungsbedingungen abhängig. Norbert Hahn erläutert, dass die Schnittgeschwindigkeit, Vorschubgeschwindigkeit, Kühlung, Schmierung, Werkzeug, Werkstück-Kombination, Spanwinkel, Schnitttiefe, Schneidengeometrie und Werkzeug/Werkstück-Schwingungen unterschiedliche Spanarten benötigt und hervorruft.

Vier Unterscheidungen zur Entstehung und Struktur der Späne:

1. Fließspan: duktile Werkstoffe, hohe Schnittgeschwindigkeit, kleiner Spanwinkel, geringe Schnitttiefe
2. Lamellenspan: diese Spanart wird in der vollautomatischen Fertigung angestrebt
3. Scherspan: vollkommene Trennung der Späne in der Scherebene und anschließendes Wiederverschweißen; Vorteil geringe Verformbarkeit des Materials
4. Reißspan: spröde Werkstoffe, kleiner Spanwinkel, Spanteile werden von der Oberfläche abgerissen, es entsteht eine raue Oberfläche

Norbert Hahn betont, dass es beim Arbeitsergebnis im Bereich Fertigungstechnik auf jeden Millimeter ankommt. Computergesteuerte Werkzeugmaschinen, die bei spanenden Arbeiten wie Drehen, Bohren, Schleifen oder Fräsen zum Einsatz kommen, unterstützen die Feinwerkmechaniker. Die Feinwerkmechaniker bei Hahn Fertigungstechnik programmieren die Werkzeugmaschinen, führen die spanenden Arbeiten durch und überprüfen das Arbeitsergebnis mittels verschiedener Messwerkzeuge. Hahn Fertigungstechnik bietet von der Reparatur über die Konstruktion von Sonderanfertigungen bis zu Neuanfertigungen ein breites Leistungsspektrum an. Die Mitarbeiter sind Teil des gesamten Leistungsspektrums und gestalten vom Prototypenbau, der Einzelanfertigung bis zur Serienfertigung an den Lösungen mit.

Fazit: „Tun lernt“ – Blick in das Unternehmen – Berufswahl einfacher nach Praktikum treffen

„Der Unternehmenserfolg spiegelt sich in qualifizierte und gut ausgebildete Mitarbeiter wieder. Diese Mitarbeiter sorgen dafür, dass aus Ideen erfolgreiche Produkte und aus Problemstellungen der unterschiedlichen Kunden spezifische Problemlösungen werden. Deshalb ist uns sehr an einer qualifizierten Ausbildung unseres Nachwuchses gelegen“, betont Norbert Hahn. Hahn Fertigungstechnik freut sich auf Praktikanten. Persönlichen Einblick in den Alltag der Fertigungstechnik erleichtert die Berufswahl. Weitere Informationen unter www.hahn-fertigungstechnik.de.

Die Hahn Fertigungstechnik GmbH in Papenburg an der Ems in Niedersachsen wurde im Jahr 2000 gegründet und beschäftigt rund 40 Mitarbeiter. Hahn Fertigungstechnik GmbH ist ein mittelständiges Unternehmen und hat sich spezialisiert auf die Bearbeitung von anspruchsvollen Dreh- und Frästeilen. Von der Konstruktion bis zur Fertigung liefert Hahn Fertigungstechnik komplett bearbeitete, einbaufertige Teile oder komplexe Baugruppen aus allen zerspanbaren Materialien. Die Reparatur von Bauteilen ist Bestandteil unseres Leistungsspektrums. Gegenseitige Synergien der Unternehmen Hahn Fertigungstechnik und Maschinenbau Hahn werden in der Konstruktion, der Aus- und Weiterbildung, der Logistik und weiteren Bereichen genutzt. Weitere Informationen unter www.hahn-fertigungstechnik.de

Kontakt
Hahn Fertigungstechnik GmbH
Norbert Hahn
Dieselstraße 1
26871 Papenburg
+49 4961 9707-0
+49 4961 6224
office@hahn-fertigungstechnik.de
http://www.hahn-fertigungstechnik.de

Allgemein

Die Sehnsucht nach Wahrheit und Liebe

und was uns sonst noch
in den Himmel zieht

Die Sehnsucht nach Wahrheit und Liebe

Cover

Orientierung auf dem geistigen Weg

„Wer bin ich?“, „Warum bin ich hier?“, „Was ist meine Aufgabe?“

Das eigene Wollen und Sehnen be-stimmt unser Voranschreiten. Im Buch werden sämtliche Themen und Inhalte behandelt, die für die indivi-duelle spirituelle Entwicklung wichtig sind. Es eignet sich sowohl zur Vorbereitung als auch als Wegbegleiter für das nicht immer leichte Unterfangen, dem inneren und äußeren Meister zu begegnen.

Möchte man spirituellen Fortschritt erlangen, ist es notwendig, Ego-Strukturen aufzulösen. Indem sie Herz und Verstand gleichermaßen berühren, geben die vorliegenden Ausführungen Impulse für den spiri-tuellen Weg und machen Mut, ihn weiter zu gehen.

Vollkommen undogmatisch und über-konfessionell bietet das Buch Frei-räume für individuelles und kreatives Vorgehen in jeder denkbaren Lebenssituation.

„Wenn wir uns auf den geistigen Weg einlassen, seriös und voll und ganz, entfällt das Zufallsprinzip für uns. Wir werden geführt und alles, was uns passiert, ist richtig für uns, ist Schulung, weist uns darauf hin, was wir zu lernen haben und was wir ändern müssen.“ (John Elissen)

Über den Autor

Nach einem bewegten Berufsleben als Schiffsoffizier, Kaufmann und Mitinhaber einer Dienstleistungsfirma zog John Elissen sich im Alter von 49 Jahren mit seiner Familie auf eine Insel im europäischen Ausland zurück. Der Wunsch nach einem natürlichen und einfachen Leben als Selbstversorger mit Bienen, Ziegen sowie eigenem Gemüse und Obst erfüllte sich für einen Zeitraum von über 20 Jahren. Dieser äußere Rahmen erwies sich als eine gute Vorbereitung für die Begegnung mit einem spirituellen Lehrer, der ihm den geistigen Weg eröffnete. Heute lebt er mit seiner Frau in ländlicher Abgeschiedenheit in Niedersachsen.

tao.de ist ein Selfpublishing-Portal, das AutorInnen mit den Themengebieten Neues Bewusstsein, Ganzheitliche Gesundheit und Spiritualität bei allen Schritten von der Idee über die Produktion von Büchern und ebooks bis zu ihrer Vermarktung begleitet. tao.de ist der Selfpublishing-Verlag der J.Kamphausen Mediengruppe.

Firmenkontakt
J.Kamphausen Mediengruppe GmbH
Kirstin Dreimann
Goldbach 2
33615 Bielefeld
0521-560520
0521-5605229
info@tao.de
www.tao.de

Pressekontakt
J.Kamphausen Mediengruppe GmbH
Julia Meier
Goldbach 2
33615 Bielefeld
0521-56052257
0521-5605229
julia.meier@j-kamphausen.de
www.tao.de

Allgemein

Lebenskunst: Selbstverwirklichung ohne Selbstbezogenheit.

Zur Möglichkeit, den Egoismus zu überwinden.

Lebenskunst: Selbstverwirklichung ohne Selbstbezogenheit.

In seinem Buch „Weltformel Seele – Quantensprung der Evolution“ spürt Ronald Kahle den Steuerungsprozessen der Natur nach und legt dabei die Zielrichtung der Evolution frei. Egoismus ist das Resultat falsch verstandener Selbstverwirklichung und arbeitet nun dem Ziel des Lebens entgegen. Die weltweiten Krisen sind die Folge und drängen den Menschen zum Umdenken. Im Selbstverständnis des Menschen und in seinem Verhältnis zur Einheit der Natur liegt die Ursache der Problematik und auch der Schlüssel zu ihrer Überwindung verborgen.

Mit ihren Beschreibungen der elementaren Bausteine der Materie, zeichnet die Quantenphysik eine Welt der Einheit als Grundlage allen Bestehens. Der Mensch dagegen erlebt sich sinnesorganisch in einer Welt der Einzelobjekte. In einem Kampf um Macht und Autonomie stellt er seine Einheit der Einheit des Universums gegenüber. So prallen Innen- und Außenwelt im Spannungsfeld von Freiheit und Determination aufeinander. Das selbststeuernde System der Natur stellt den Menschen vor seine Eigenverantwortung, mit dem Ziel, ihn in einen bewussten, selbstschöpferischen Prozess hineinzuführen. Dazu wird dem Menschen aber eine sehr tiefgreifende Selbsterkenntnis abverlangt, denn er vermag den gestellten Anforderungen nur zu genügen, wenn es ihm gelingt von der biologisch bedingten, oberflächlichen Selbstbezogenheit durchzudringen zu seinem wahren Wesens- oder Seelenkern, der Anteil hat an der Welt der Einheit. Es ist der Quell seiner Sehnsucht und der Geburtenschoß der Ideale, den C. G. Jung als „Nicht-Ich-Zentrum“ charakterisiert, die Bibel als „Samenkorn Christi“ und Schiller als „Götterfunken“. Als Anknüpfungspunkt der Einheit ist dieser die Basis allen wahrhaft menschlichen Werdens.

In einem tief eingreifenden Seelenprozess sind die, infolge überspannter Selbstbezogenheit verworrenen Informationsstrukturen aufzulösen und im Geist der Einheit neu zu ordnen. Dabei wird hinter der scheinbaren Irrationalität des Lebens und den komplementären Polaritäten der Natur eine regenerative Ordnungsstruktur sichtbar, die den Menschen in einer zielgerichteten Evolution aus der relativistischen Welt subjektiver Erscheinungen zum wahrhaften Sein der Einheit führen will.

„Weltformel Seele – Quantensprung der Evolution“ ist als flott geschriebenes populärwissenschaftliches Sachbuch abgefasst, das zu tiefem Nachdenken anregt.

Autor:
Als Ingenieur im naturwissenschaftlich-physikalischen Bereich zu Hause, hat sich der Autor über 30 Jahre im Rahmen einer modernen Philosophenschule ernsthaft in Theorie und Praxis mit den elementaren Lebensfragen der Menschheit auseinandergesetzt. Die nüchterne Denkweise fordert dabei mit der Wissenschaft vereinbare Aussagen, das fühlende Herz zugleich – und auf Augenhöhe mit dieser – eine ganzheitliche Sichtweise und einen praktikablen Weg für jedermann.

Ronald Kahle
Weltformel Seele – Quantensprung der Evolution
Sachbuch, populärwissenschaftlich
Tredition, Hamburg
1. Auflage, 2015, 428 Seiten
ISBN 978-3-7323-1185-9
EUR 19,95
Auch als Hardcover und e-Book.
https://tredition.de/publish-books/?books/ID42153/Weltformel-Seele

Weitere Informationen:
http://weltformelseele.jimbo.com

Text:
Ronald Kahle

Die tredition GmbH ist ein Hamburger Unternehmen, das Verlags- und Publikations-Dienstleistungen für Autoren, Verlage, Unternehmen und Self-Publishing-Dienstleister anbietet. tredition vertreibt für seine Kunden Bücher in allen gedruckten und digitalen Ausgabeformaten über alle Verkaufskanäle weltweit (stationärer Buchhandel, Online-Stores) mit Einsatz von professionellem Buch- und Leser-Marketing.

Der 2006 gegründete Anbieter ist darauf spezialisiert, durch das Optimieren von Auflagenmanagement, Vertrieb und Abrechnungswesen die Erträge für Verlage, Unternehmen und Autoren zu maximieren. tredition ist Preisträger des Webfuture Awards der Hansestadt Hamburg und erhielt den Förderpreis des Mittelstandsprogramms. Darüber hinaus gewann das Unternehmen den Preis Digitale Innovation Pitch (BUIDP). Neben privaten Autoren auf seinem eigenen Self-Publishing-Portal tredition.de hat tredition auch Unternehmen wie brand eins, Hamburger Abendblatt, Hamburger Morgenpost, Neue Westfälische, Bucerius Law School, kress, CHIP oder Der 2006 gegründete Anbieter ist darauf spezialisiert, durch das Optimieren von Auflagenmanagement, Vertrieb und Abrechnungswesen die Erträge für Verlage, Unternehmen und Autoren zu maximieren. tredition ist Preisträger des Webfuture Awards der Hansestadt Hamburg und erhielt den Förderpreis des Mittelstandsprogramms. Darüber hinaus gewann das Unternehmen den Preis Digitale Innovation Pitch (BUIDP). Neben privaten Autoren auf seinem eigenen Self-Publishing-Portal tredition.de hat tredition auch Unternehmen wie brand eins, Hamburger Abendblatt, Hamburger Morgenpost, Neue Westfälische, Bucerius Law School, kress, CHIP oder die Kamphausen Mediengruppe im Kunden-Portfolio.

Firmenkontakt
Autor bei Tredition
Ronald Kahle
Grindelallee 188
20144 Hamburg
040-41 42 778 00
040-41 42 778 01
info@tredition.de
http://www.tredition.de

Pressekontakt
Tredition
Nadine Otto
Grindelallee 188
20144 Hamburg
040-41 42 778 00
040-41 42 778 01
presse@tredition.de
http://www.tredition.de

Allgemein

Chancen im Homeoffice richtig wahrnehmen

Mobiles Arbeiten für Mütter

Chancen im Homeoffice richtig wahrnehmen

txn.

txn. Homeoffice und Telearbeit gelten als Trends und Symbole der modernen Arbeitswelt. Beruf und Familie können besser miteinander vereinbart werden. Pendler sparen viel Zeit und Arbeitgeber reduzieren Büroflächen. Zumindest technisch kann fast jeder Büroarbeitsplatz zu geringen Kosten an den heimischen Schreibtisch verlegt werden. Dafür reicht eine schnelle Internet-verbindung, die den Zugriff auf Anwendungen, Datenbanken und Kommu-nikationssysteme des Arbeitgebers ermöglicht. Das klingt alles gut – aber nachdem Homeoffice-Arbeitsplätze ab der Jahrtausendwende zeitweilig sehr trendy warfen, ist die Zahl der Personen mit häuslicher Erwerbstätigkeit seit 2008 bundesweite um insgesamt 800.000 gesunken.

„Diese Entwicklung ist bedauerlich. Für eine gute Lebensbalance zwischen Arbeit, individuellen Bedürfnisse und persönlichem Lebensstil bieten flexible Arbeitsmodelle wie zum Beispiel Heim- oder Telearbeit viele Chancen“, stellt Petra Timm, Unternehmenssprecherin beim Personaldienstleister Randstad fest. „Für die bessere Vereinbarkeit von Familie und Beruf und die vielen qualifizierten Mütter brauchen wir daher einen Wandel in den Unternehmen – weg von der Präsenzkultur mit Anwesenheitspflicht, hin zu mehr Effizienz und Flexibilität“, so Petra Timm weiter.

Aber eine derartige Veränderung muss sehr sorgfältig gestaltet werden. Denn wer physisch nicht präsent ist, wird leicht übergangen und gerade Frauen mit Kindern werden gern als „Muttis“ abgestempelt, die zu Hause aus Gründen der Selbstverwirklichung ein bisschen vor sich hin werkeln. Daher gilt: Aus den Augen, aber nicht aus dem Sinn! Arbeitnehmer und Arbeitgeber, die sich für eine Homeoffice-Lösung entscheiden, sollten mit festen Vereinbarungen die Grundlage für eine verlässliche Zusammenarbeit schaffen, Fragen der Personalführung klären und regulatorische Sicherheiten schaffen. Welche Arbeitszeiten gelten generell? Gibt es Kernarbeitszeiten, die auch am heimischen Schreibtisch einzuhalten sind? Muss der Heimarbeiter zu bestimmten Zeiten für den Vorgesetzten, die Kollegen oder Kunden erreichbar sein? Zudem sollte schriftlich fixiert sein, wer für die Anschaffung und Instandsetzung der Arbeitsgeräte wie Laptop, PC, Smartphone und Handy verantwortlich ist und die Kosten für den Internetzugang trägt. Und dürfen die Geräte auch privat genutzt werden, obschon die Pflicht zur Vertraulichkeit auch im Homeoffice gilt? Eine genaue vertragliche Regelung dieser Fragen liegt sowohl im Interesse des Arbeitgebers als auch des Arbeitnehmers. Nur so können Unstimmigkeiten vermieden und die Grenzen zwischen Arbeit und Privatleben deutlich gekennzeichnet werden.

Bleibt noch festzustellen: Das Homeoffice als Alternative zum klassischen Büroalltag funktioniert auch als Mischform – beispielsweise zwei Tage zuhause und drei im Unternehmen. Eine solche Form des mobilen Arbeitens erhöht die Attraktivität als Arbeitgeber maßgeblich und wird im Wettbewerb um Fachkräfte zu einem echten strategischen Vorteil.
„Die Arbeit im Homeoffice gehört in die moderne Arbeitswelt. Vielleicht nicht als Standard, weil Menschen andere Menschen brauchen, um gute Ideen zu entwickeln – aber bei Bedarf“, fasst Petra Timm von Randstad die kontroverse Debatte zusammen.

[Bildunterschrift]
txn. Unternehmen erhöhen ihre Attraktivität, wenn sie berufstätigen Müttern zumindest zeitweise die Möglichkeit bieten, im Homeoffice zu arbeiten. Voraussetzung dafür ist jedoch ein Umdenken: Statt anwesenheitsbezogener Arbeitszeit steht muss die Ergebnisorien-tierung im Vordergrund stehen. Hierfür die nötigen Unternehmensstandards zu schaffen, ist zunächst vielleicht aufwendig, lohnt sich aber schon mittelfristig, wenn wertvolle Fachkräfte im Unternehmen gehalten werden können.

Randstad – Die Nummer 1 in Deutschland.
Mit durchschnittlich rund 63.000 Mitarbeitern und 500 Niederlassungen in rund 300 Städten ist Randstad der führende Personaldienstleister in Deutschland. Beschäftigt und gesucht werden Mitarbeiter mit ganz unterschiedlichen Qualifikationen, vom Industriemechaniker über Buchhalter und kaufmännische Mitarbeiter bis hin zu Ingenieuren oder IT-Spezialisten. Während der wechselnden Einsätze in Kundenunternehmen sammeln die Arbeitnehmer von Randstad wertvolle Praxiserfahrungen und lernen verschiedene Unternehmen, Aufgabengebiete und Kollegen kennen. Für viele ist die Beschäftigung bei Randstad auch ein Sprungbrett in den Traumjob: Im Schnitt werden rund 30 Prozent der überbetrieblichen Mitarbeiter vom Kundenunternehmen übernommen.

Kontakt
Randstad Deutschland
Helene Schmidt
Helfmann-Park 8
65760 Eschborn
06196 4081701
Helene.Schmidt@de.randstad.com
http://randstad.de

Allgemein

Lebensträume verwirklichen

Mittels Online-Coaching zur Selbstverwirklichung

Lebensträume verwirklichen

Lebe deinen Traum

„Soll das schon alles gewesen sein?“, mögen Sie sich fragen und nach dem Sinn des Lebens suchen. In der Zeit der Transformation, in der wir uns befinden, stellen immer mehr Menschen fest, dass sie an ihrem Platz nicht richtig sind. Sie sind ausgelaugt und unzufrieden. Lustlos gehen sie täglich zur Arbeit, laufen in der Gesellschaft mit, weil man es eben so macht, oder sie wissen nicht so recht, was sie tun sollen, nachdem die Kinder nun endlich aus dem Haus sind. „Kraftvoll durchstarten gemäß dem Motto ´Jetzt bin ich dran!““ heißt das Programm eines Online-Coaching-Kurs , der im Januar 2015 beginnt.

Komfortzone verlassen und Veränderung wagen

„Entdecke und lebe deinen Traum!“, heißt das Ziel des Coachings. Es richtet sich an Menschen, die vielleicht wissen, was sie gerne tun würden, die aber irgendetwas blockiert. Menschen, denen der Mut und die Klarheit fehlen, um alleine zu einer Lösung zu kommen, sind ebenfalls in dem Programm richtig. Der Kurs richtet sich genauso an Männer und Frauen, die das Gefühl haben, bisher immer nur Verpflichtungen und Erwartungen anderer erfüllt zu haben, die gleichzeitig Angst vor einer Veränderung verspüren und doch lieber in ihrer Komfortzone verharren. Ihre eigenen Träume haben viele Menschen aus den Augen verloren und sie wissen gar nicht mehr, was ihr ureigener Traum einmal war. Denjenigen, die sich nach mehr Sinn in ihrem Leben sowie nach Orientierung und Erfüllung sehnen, kann der Online-Kurs helfen.

Das Coaching begleitet Menschen auf ihrem Weg zur Selbstverwirklichung . Das Programm hilft den Teilnehmern, einen großen Schritt in ihrer Persönlichkeits- und Bewusstseinsentwicklung zu machen. Der 14-wöchige Kurs führt die Teilnehmer zu Klarheit, Orientierung und einem Überblick über ihren weiteren Weg. Das Coaching motiviert die Klienten, einen Neubeginn zu wagen und voller Elan und kreativer Energie durchzustarten. Ferner versetzt es die Teilnehmer in die Lage, künftig bewusster und freier zu handeln. Sie folgen ihrem ureigenen Weg, auf dem sie ab sofort selbst Regie führen, ihren Traum erkennen und verwirklichen können. Die Teilnehmer entdecken den Sinn ihres Lebens und erfahren zutiefste Erfüllung.

Kostenloses Info-Webinar vorab

Wer sich nicht sicher ist, ob das Online-Coaching für ihn das Richtige ist, kann dies in einem kostenlosen Info-Webinar herausfinden. Es wird ab Donnerstag, den 13. November 2014 alle 14 Tage angeboten und beantwortet alle wichtigen Fragen zum Coaching-Programm, wie zum Beispiel „Wie läuft das Coaching ab?“ oder „Wie sieht die Unterstützung während des Kurses aus?“. Die Teilnehmer des Info-Webinars erwartet ein kurzer Impuls-Vortrag zum Thema Lebenstraum. Danach stellt Coach Bianka Maria Seidl zusammen mit Moderatorin Christine Kohl den Online-Kurs vor.Zu weiteren Details sowie zur Anmeldung zum kostenlosen Info-Webinar geht es hier: Info-Webinar

Coaching parallel zum Arbeitsalltag

Coach Bianka Maria Seidl startet das Online-Coaching am 2. Januar 2015 um 19 Uhr mit einem inspirierenden Auftakt-Webinar. In der Folgezeit erhalten die Teilnehmer in 7 Modulen Informationen, Fragen und Aufgaben auf dem Weg zur Verwirklichung ihres ureigensten Traumes. Sie finden im Forum des Mitgliederbereichs engagierte Gleichgesinnte, die sich gegenseitig unterstützen und bestärken. Auf Wunsch können sich Erfolgsteams und Tandems zum gegenseitigen Austausch bilden. Darüber hinaus wird es zwei Online-Workshops und ein Frage-Antwort-Webinar geben. Das Kursprogramm endet mit einem Abschluss-Webinar am 10. April 2015. Das Coaching ist so konzipiert, dass es parallel zum privaten und beruflichen Alltag durchgeführt werden kann und sich die Teilnehmer in den 14 Wochen intensiv mit sich selbst auseinandersetzen können. Anmeldeschluss ist am 31.12.2014.

Klicken sie hier für mehr Informationen über den Online-Coaching-Kurs zur Selbstverwirklichung.

Kursleiterin lebt ihren eigenen Traum

Entwickelt wurde der Online-Kurs von Bianka Maria Seidl aus Windberg in Niederbayern. Die Autorin und Künstlerin arbeitet seit vielen Jahren auch als Coach. Die 55-Jährige ist seit über zwei Jahrzehnten selbstständig. Sie liebt das Leben und die Schöpfung und bezeichnet sich selbst Abenteurerin. „Meine Mission ist es, dem Leben zu dienen, indem ich Festgefahrenes löse und den Samen der Freiheit säe. Freude, Schönheit und Harmonie sind die Säulen, auf denen mein Leben jetzt aufgebaut ist. Das war nicht immer so“, verrät sie über sich selbst. Klicken Sie hier für mehr Informationen über Coach Bianka Maria Seidl

yoYa Bewusstsein
Coaching & Seminare

• Spirituelles Coaching
• systematische Aufstellungsarbeit
• schamanische Praktiken
• Seminarreisen mit Schwerpunkt Sinn, Werte, Vision

Kontakt
yoYa Bewusstsein
Bianka Maria Seidl
Pfarrplatz 4
94336 Windberg
09422 4032488
info@yoya-bewusstsein.de
http://www.yoya-bewusstsein.de

Allgemein

SIBE startet Studiengang für »Unruhegeister«

Dieses Jahr startet der »Master of Arts in Philosophie.Kultur.Gesellschaft« für Menschen mit reichhaltiger und vielfältiger Lebenserfahrung. Das Besondere: Im Rahmen des Studiums planen und verwirklichen die Teilnehmer gemeinsam ein gesellschaftlich relevantes Projekt.

Im Mittelpunkt steht nicht die Weiterbildung für das Berufsleben – sondern das Interesse und die Neugierde, sich mit aktuellen Themen aus Philosophie, Kultur und Gesellschaft auseinanderzusetzen, sich auf eine neue Lebensphase zu besinnen und die Persönlichkeit weiterzuentwickeln. Hierzu werden wissenschaftlich aktuelle und existenzielle Themen aus Philosophie, Wissenschaft, Forschung und Medizin, Gesellschaft, Theologie, Politik, Kunst und Wirtschaft angesprochen. Außerdem bietet der Studiengang die Chance, sich mit der Sinnfrage des eigenen Lebens zu beschäftigen.

Das Besondere: Die Studierenden des Master of Arts in Philosophie.Kultur.Gesellschaft. entwickeln und realisieren gemeinsam ein Projekt. Die Gruppe organisiert die Finanzierung des Projektes selbst – durch Fundraising, über Zusammenarbeit mit Sponsoren, Politik oder auch die Gründung einer Stiftung. Angesichts der immensen Kompetenz und Erfahrung, die eine solche Gemeinschaft besitzt, sind die Studierenden angehalten groß zu denken: Das Projekt soll einen wesentlichen Beitrag zur Lösung größerer sozialer, politischer, ökologischer, technischer oder wirtschaftlicher Probleme leisten.

Das Studium dauert 24 Monate, jährlich sind 30 Präsenztage in Stuttgart, Berlin und München angesetzt. In den Seminaren werden u.a. folgende Themen diskutiert: Spiritualität und Weisheit, Gesundheit und Vitalität, Lebensphasen und Glück, gesellschaftlicher Wandel, digitales Leben, Wirtschaft und Ethik, Politik und Vernunft, demografischer Wandel und Generationengerechtigkeit. Für die Arbeit am Projekt sind zusätzlich gemeinsame Kolloquien und Projektreffen geplant. Außerdem wird eine Studienreise in Form eines Klosteraufenthalts organisiert.

Unternehmen hingegen haben die Möglichkeit, dieses Projekt in Ihre CSR-Aktivitäten einzubinden – Sie bringen damit Ihren Mitarbeitern Wertschätzung entgegen, übernehmen Verantwortung und tragen als Unternehmen aktiv zur Lösung gesellschaftlich relevanter Probleme bei. So profitieren alle: Ihre Mitarbeiter, Ihr Unternehmen und die Gesellschaft.

Dozenten des Studiengangs sind unter anderem: Prof. Dr. Julian Nida-Rümelin (Philosoph und Staatsminister a. D.), Prof. Dr. Rudolf Tippelt (Bildungsforscher), Udo Pollmer (Ernährungswissenschaftler), Prof. Dr. Martin K. Welge (Wirtschaftswissenschaftler) und Prof. Dr. John Erpenbeck. (Kompetenzforscher und Wissenschaftsphilosoph).

Für die Ausgestaltung und Weiterentwicklung des Master of Arts in Philosophie.Kultur.Gesellschaft. sorgt ein namhafter Beirat: Uschi Glas (Schirmherrin der Patientenschutzorganisation Deutsche Hospiz Stiftung, Vorstand des Vereins BrotZeit e.V.), Prof. Dr. Helmut Haussmann (Honorar-Professor für internationales Management und Bundeswirtschaftsminister a.D.), Prof. Dr. Hans Palmtag (Vorstandsmitglied der deutschen Gesellschaft für Urologie und Partner der VfB Reha-Welt Stuttgart), Edzard Reuter (Buchautor und ehemaliger Vorsitzender des Vorstands der Daimler-Benz AG), Claus Schmiedel (Vorsitzender der SPD-Landtagsfraktion in Baden Württemberg) und Prof. Dr. Harald Unkelbach (Mitglied der Geschäftsleitung der Adolf Würth GmbH und Vorstand der Stiftung Würth).

Am Dienstag, 8. April 2014 um 17-19 Uhr findet im Haus der Wirtschaft in Stuttgart eine Informationsveranstaltung und Studienberatung statt. Anmeldungen bitte an vandesandt@steinbeis-sibe.de oder telefonisch an 0176-63 67 83 49.

Das Studium kann ab Juni aufgenommen werden, Bewerbungen sind jederzeit möglich. Weitere Informationen finden sich hier: www.sibe-philosophie.de .

Die SCHOOL OF INTERNATIONAL BUSINESS AND ENTREPRENEURSHIP (SIBE) ist die internationale Business School der Steinbeis-Hochschule Berlin (SHB) mit Sitz in Herrenberg und Berlin – geleitet wird die Hochschule von Prof. Dr. Werner G. Faix, der die SIBE gegründet hat.
Die SIBE steht für erfolgreichen Wissens-Transfer und systematischen Kompetenz-Aufbau zwischen Wissenschaft und Wirtschaft. Sie ist fokussiert auf Unternehmen, Organisationen und öffentliche Verwaltungen und auf kompetente, unternehmerisch global denkende und handelnde High Potentials. Wir sorgen mit unseren Innovations-Projekten und unseren High Potentials bei unseren Partner-Unternehmen für Wachstum und Globalisierung – und für kompetente Führungs- und Nachwuchsführungskräfte.

Mit MBA- und Masterprogrammen (Master of Laws, M.A. und M.Sc. im Double-Degree) seit 1994, mit derzeit über 1.074 Studierenden, mehr als 2.300 erfolgreichen Absolventen und mit über 350 Partner-Unternehmen ist die SIBE kompetenter Partner für Wachstum, Globalisierung und Weiterqualifizierung.

School of International Business and Entrepreneurship (SIBE)
Sandra Flint
Gürtelstraße 29a/30
10247 Berlin
0176 – 1945 8015
flint@steinbeis-sibe.de
http://www.steinbeis-sibe.de

SIBE GmbH
Sandra Flint
Gürtelstr. 29a/30
10247 Berlin
030/49782220
flint@steinbeis-sibe.de
http://www.steinbeis-sibe.de

Allgemein

Prof. Dr. Lothar Seiwert als Talk-Gast in der CONMEDIA in Stuttgart

Am 14. Januar 2014 lädt die Hochschule der Medien (HdM) Europas führenden Zeitexperten zum Live-Talk ein

Prof. Dr. Lothar Seiwert als Talk-Gast in der CONMEDIA in Stuttgart

CONMEDIA: 14.01.2014

Die Hochschule der Medien (HdM) hat unter dem Namen CONMEDIA eine Studenten-Experten-Talkrunde eingeführt, in denen Studierende aus verschiedenen Fakultäten gesellschaftspolitischen Themen auf den Grund gehen sollen. Zum Thema „Work-Life-Balance: Mein Job, mein Leben – und ich?“ wird am 14. Januar 2014 der führende Zeit- und Lebensmanagement-Experte Prof. Dr. Lothar Seiwert zu den Studenten sprechen. Sein Zeit-Balance-Modell diente als Grundlage für die Konzeption der Veranstaltung. Er wird neben den Faktoren Arbeit und Familie im Speziellen auf die Themen Lebenssinn und Motivation eingehen.

Die langjährige Erfahrung von Prof. Dr. Lothar Seiwert auf diesem Gebiet und seine internationalen Erfolge als Sachbuchautor zu den Themen Zeit- und Lebensmanagement machen ihn zum perfekten Kandidaten, um die CONMEDIA auf wissenschaftlicher Ebene zu begleiten. Schon lange gilt Seiwert als prominentes Vorbild, wenn es darum geht, sich im Leben auf das Wesentliche zu fokussieren.

Mit dabei sind außerdem der ehemalige Fußballprofi und heutige Fußballfunktionär Hansi Müller, der ehemalige Redaktionsleiter von Harald Schmidt, Autor und Moderator Manuel Andrack sowie die FDP-Politikerin und Rechtsanwältin Judith Skudelny. Moderiert wird die Veranstaltung durch Elsa Rüf (EMM-Studentin und Anchor-Moderatorin der Kindersendung Kri Kra Kraex auf BW Family TV) sowie Martin Hoffmann (Moderator TV-Südbaden).

Der Live-Talk findet am 14. Januar 2014 von 19 bis ca. 20:15 Uhr (Einlass ab 18 Uhr) in der Hochschule der Medien (HdM) statt und wird zudem live ins Internet gestreamt. Den Livestream kann man am Veranstaltungsabend über folgenden Link erreichen: mw.hdm-stuttgart.de/~conmedia/ws1314/live

Die CONMEDIA findet bereits zum zwölften Mal statt. 34 Studenten aus den Studiengängen „Medienwirtschaft“ (Bachelor) und „Elektronische Medien“ (Master) geben sich die Struktur eines Medienunternehmens, um ein gesellschaftlich relevantes Thema für eine breite Öffentlichkeit zu übersetzen. Sie arbeiten in fächerübergreifenden Teams wie Technik, Redaktion, Event, Finanzen und Marketing und setzen das komplette Projekt selbstständig um. Ziel und Höhepunkt dieses Projekts ist die eigenständige Konzeption und Realisation eines Live-Talks im Foyer der Hochschule vor circa 400 Zuschauern.

Mehr Informationen zu Prof. Dr. Lothar Seiwert unter www.Lothar-Seiwert.de
Mehr Informationen zu Hochschule der Medien unter www.hdm-stuttgart.de
Mehr Informationen zur CONMEDIA unter http://mw.hdm-stuttgart.de/~conmedia/ws1314/

Wer sich mit den Themen Zeitmanagement und Work-Life-Balance beschäftigt, kennt Prof. Dr. Lothar Seiwert. Seit über 30 Jahren begeistert der von der Zeitschrift Focus als „Deutschlands führender Zeitmanagement-Experte“ betitelte Redeprofi auf internationalen Veranstaltungen. Das, was er macht, macht er mit System und sensibilisiert in seinen nachhaltigen Vorträgen für das Kostbarste, das wir besitzen: unsere Zeit. Millionen Menschen weltweit haben von ihm durch Vorträge, Fernsehauftritte, Pressekolumnen und Bücher gelernt, mit ihrer Zeit besser umzugehen. Mehr als 400.000 Zuhörer haben ihn bei Veranstaltungen in Europa, Asien und den USA als Speaker erlebt.

Als Bestsellerautor und Business-Speaker wurde Lothar Seiwert vielfach ausgezeichnet. U.a. erhielt er den Benjamin-Franklin-Preis („Bestes Business-Buch des Jahres“), den Internationalen Deutschen Trainingspreis, den Life Achievement Award und den Conga-Award als bester Business-Speaker der Deutschen Veranstaltungsbranche. Die German Speakers Association (GSA) ehrte ihn mit der Aufnahme in die „Hall of Fame“ der besten Vortragsredner. In den USA wurde Prof. Dr. Seiwert mit dem höchsten und härtesten Qualitätssiegel für Vortragsredner, dem CSP (Certified Speaking Professional), ausgezeichnet. www.Lothar-Seiwert.de

Kontakt
Seiwert Keynote-Speaker GmbH
Prof. Dr. Lothar Seiwert
Adolf-Rausch-Straße 7
69124 Heidelberg
0 62 21/78 77-0
presse@seiwert.de
http://www.Lothar-Seiwert.de

Pressekontakt:
werdewelt GmbH
Benjamin Schulz
Lindersrain 2
35708 Haiger
02773 74 37 0
jaeger@werdewelt.info
http://www.werdewelt.info